PD-1 anticorps (AA 84-117)

N° du produit ABIN5647075

L’anticorps Lapin Polyclonal anti-PD-1 a été validé pour WB et IHC (p). Il convient pour détecter PD-1 dans des échantillons de Souris et Rat.

Aperçu rapide pour PD-1 anticorps (AA 84-117) (ABIN5647075)

Antigène: PD-1 (PDCD1) (Programmed Cell Death 1 (PDCD1))

Reactivité: Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PD-1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Détail du produit anti-PD-1 anticorps

Épitope: AA 84-117

Purification: Antigen affinity purified

Pureté: Antigen affinity

Immunogène: Amino acids 84-117 (NGLSQPVQDARFQIIQLPNRHDFHMNILDTRRND) from the mouse protein were used as the immunogen for the PD-1 antibody.

Isotype: IgG

Information d'application

Indications d'application: Optimal dilution of the PD-1 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

Restrictions: For Research Use only

Stockage

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Stock: -20 °C

Stockage commentaire: After reconstitution, the PD-1 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Détails sur PD-1

Antigène: PD-1 (PDCD1) (Programmed Cell Death 1 (PDCD1))

Autre désignation: PDCD1 / PD-1

Sujet: PDCD1 (Programmed cell death 1), also called PD1, encodes a cell surface receptor that is a member of the B7 superfamily involved in immunomodulation. This gene is mapped to 2q37.3. PDCD1 acts as an inhibitory molecule on T cells after interacting with its ligands PDL1 and PDL2. The PDCD1 gene contains 5 exons. This protein is expressed in pro-B-cells and is thought to play a role in their differentiation. Using flow cytometric analysis, it has been found that expression of PDCD1 was upregulated on CD16-positive and CD16-negative monocytes, but not on dendritic cells, in viremic HIV-positive patients, but not in highly active antiretroviral therapy (HAART)-treated HIV-positive patients. PDCD1 upregulation in monocytes was induced by microbial Toll-like receptor ligands and inflammatory cytokines.

UniProt: Q02242

Pathways: Cancer Immune Checkpoints